PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim09g010680.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 399aa    MW: 42445.5 Da    PI: 9.5238
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim09g010680.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1208.4e-3882141362
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         e+alkcprCdstntkfCy+nnyslsqPr+fCkaC+ryWt+GGalr vPvGgg+r+nk+s+
  Sopim09g010680.0.1  82 ETALKCPRCDSTNTKFCYFNNYSLSQPRHFCKACKRYWTRGGALRSVPVGGGCRRNKRSN 141
                         6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3465134IPR003851Zinc finger, Dof-type
PfamPF027011.9E-3284139IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.24585139IPR003851Zinc finger, Dof-type
PROSITE patternPS01361087123IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MNFSSIPAYL DPANWQQQSG STIQNHHHHQ QQQLTSAPPP PVLPPGPPVV APLQPHGGGG  60
AGSIRPGSMA DRARMANITM PETALKCPRC DSTNTKFCYF NNYSLSQPRH FCKACKRYWT  120
RGGALRSVPV GGGCRRNKRS NNNNKNSTNN NNNNNSSKSP ASSTSTDGRQ GTNNSGSSTT  180
ISSHSNSFSG PTSAASLLGL MSPQIPPLRF MSPLGQFSSD HHHHHHFTPS NHMNLNFSTS  240
SCGNILGGTT EGMMVSNNNL LGTGTGAGVG GHVASLLSSG NLEHWRMQQQ FPNFLGGFDP  300
SNSPSSYPFQ GGVHEAVQYL GGESTSQISR PKISTSMLNQ MASVKMEDNN NNNSNQDQSA  360
LSRQLLGIQG NNENWNTSAS AWSDLSASFS SSSTSNAL*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755210.0HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246430.10.0PREDICTED: dof zinc finger protein DOF2.4
TrEMBLK4CR950.0K4CR95_SOLLC; Uncharacterized protein
STRINGSolyc09g010680.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.12e-43Dof family protein